PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004500020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 272aa    MW: 30041.3 Da    PI: 4.9727
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004500020.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.53e-4071061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lr+kC+++C +apyf  ++p++fa vh++FGas+v kllk+l+ e+reda++sl+yeAe r+rdPvyG+vg+i+ lqq+l++ ++el+
  XP_004500020.1   7 PCAACKFLRQKCTQECYFAPYFSPDNPQRFASVHRVFGASKVAKLLKELHAEDREDAVKSLAYEAESRIRDPVYGCVGFISVLQQRLKEIRNELQ 101
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +k+e
  XP_004500020.1 102 IAKKE 106
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.8216107IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-407104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRQKCTQ ECYFAPYFSP DNPQRFASVH RVFGASKVAK LLKELHAEDR  60
EDAVKSLAYE AESRIRDPVY GCVGFISVLQ QRLKEIRNEL QIAKKELLNY NFNPQTMNYL  120
LANPGTVIMP QQQQQQQWNP QFAGLNNGSN NFGNDTVGGV GELVVSDAQQ HQEQEFLEAQ  180
RFVAATQQEY FLRLGGGGVG VGVGVASSLG MGNFENGGGD YYRIEQQGEE QQQNYVALGN  240
GHPIEAQLMF SPQNQETSED GRSVGSAHPS CN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004500020.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FKZ38e-55LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A072UWH31e-105A0A072UWH3_MEDTR; LOB domain protein
STRINGGLYMA05G09950.23e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2412233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-55ASYMMETRIC LEAVES 2-like 1